PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000208448
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 335aa    MW: 36311.7 Da    PI: 7.8066
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000208448genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.54.7e-111254444
                     S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     WT e d+ + +a + ++ +   +W++Ia+ ++ g+tl+++k+++
    MDP0000208448 12 WTREQDKAFENALAIYPEDsldRWEKIAADVQ-GKTLEEIKHHY 54
                     ********************************.**********9 PP

2Myb_DNA-binding27.38.4e-09172210947
                      HHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   9 dellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
    MDP0000208448 172 LRLFLLGLEKYGKGDWRSISRNFVVTRTPTQVASHAQKY 210
                      5689999*******************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.241762IPR017884SANT domain
SMARTSM007173.5E-8860IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-41058IPR009057Homeodomain-like
SuperFamilySSF466895.23E-111065IPR009057Homeodomain-like
PfamPF002493.3E-81254IPR001005SANT/Myb domain
CDDcd001677.03E-91254No hitNo description
SMARTSM007178.9E-4160213IPR001005SANT/Myb domain
PROSITE profilePS512938.102162215IPR017884SANT domain
SuperFamilySSF466891.87E-10171216IPR009057Homeodomain-like
CDDcd001671.03E-6171211No hitNo description
PfamPF002496.9E-7171210IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-6171209IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-11173213IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MTVEEAGCSS LWTREQDKAF ENALAIYPED SLDRWEKIAA DVQGKTLEEI KHHYGLLLED  60
ISQIEAGVVP LPCYNSSSEG STSHASDEGT NKKGGHSGNY SSESNHGSKA SRADQERRKG  120
IAWTEDEHSF WHTALLHWAK KPLILNLALV RNLDLNSNCH HENWFVYGRI ELRLFLLGLE  180
KYGKGDWRSI SRNFVVTRTP TQVASHAQKY FIRLNSMNKD RRRSSIHDIT SVNNGEISAA  240
QGPITGQANG AAVGSSGKST KQSPAGAPGV GMYGNAPSIG QPIGGPLVSA VGTPVNLPAP  300
PHMAYGVSAP VPGVVPGAPM NMVPMTYPMP HSSHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A6e-17777676RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.106760.0bud| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008340430.10.0PREDICTED: transcription factor DIVARICATA
RefseqXP_008340429.10.0PREDICTED: transcription factor DIVARICATA
RefseqXP_008340428.10.0PREDICTED: transcription factor DIVARICATA
RefseqXP_008340427.10.0PREDICTED: transcription factor DIVARICATA
RefseqNP_001280907.10.0transcription factor DIVARICATA
TrEMBLD9ZJ760.0D9ZJ76_MALDO; MYBR domain class transcription factor
STRINGGLYMA07G28310.11e-157(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46943358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-105MYB family protein